PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g007853m
Common NameCISIN_1g0078531mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 588aa    MW: 65576.2 Da    PI: 4.7719
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g007853mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS447.87.1e-1372175871374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA  +s+g+ e+a++++++l++++s +gdp qR+aay++e+Laar+a s++ lykal+++e +   ss++laa+++++ev+P++k
  orange1.1g007853m 217 LKQLLIDCAATLSDGNIEEATTIINELRQMVSIQGDPPQRIAAYMVEGLAARMAASGKFLYKALKCKEPP---SSDRLAAMQILFEVCPCFK 305
                        689******************************************************************9...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        f++++aN aI ea++ge+rvHiiDfdi+qG Q+++L+q++as p++ p+lR+Tgv++pes+      l+ +g rL+++Ae+lgvpfef++ v
  orange1.1g007853m 306 FGFMAANGAIIEAFKGEKRVHIIDFDINQGSQYITLIQTIASLPGNRPHLRLTGVDDPESVqrLVGGLQIIGLRLESLAEALGVPFEFHA-V 396
                        ***********************************************************99666789***********************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         ++++ +++++L+++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++F+ rf+ea +yys++f+sl+a+
  orange1.1g007853m 397 PSKTSLVTPSMLECRPGEALVVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTSPFFPRFIEAYNYYSVVFESLDAT 488
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        lpres++r++vEr++l+r+ivn++aceg+er+er e ++kWr+r+++aGF++ p+s ++++ ++ l++++ ++ y+++ee g l +gW+d++
  orange1.1g007853m 489 LPRESQDRMNVERQCLARDIVNIIACEGEERIERYELAGKWRARMTMAGFTSCPMSADVTDMIRKLIKQYCDR-YKLKEELGLLHFGWEDKS 579
                        **********************************************************************966.****************** PP

               GRAS 367 LvsvSaWr 374
                        L+++SaW+
  orange1.1g007853m 580 LIVASAWK 587
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.413191568IPR005202Transcription factor GRAS
PfamPF035142.4E-134217587IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MSLVSSPEPS ATSYRKTKLY TLKGSGHSSA LSTQAFGSDK HKMMCQTDSY SSENYEDYIL  60
DSPTEELIHP SSSADSGNSF QRQGAPSHQL RAGSSFPMAA QSPLDSSFMS MRRCHGYQPS  120
FESGYLENQC PDPVDYDEDT MRLKLQELER ALLDDTVGDE DDDMFATIQN MEVEGEWPEP  180
VQNVPFHDSP KESSSSDSIL SSISSNKEVS QLSPRTLKQL LIDCAATLSD GNIEEATTII  240
NELRQMVSIQ GDPPQRIAAY MVEGLAARMA ASGKFLYKAL KCKEPPSSDR LAAMQILFEV  300
CPCFKFGFMA ANGAIIEAFK GEKRVHIIDF DINQGSQYIT LIQTIASLPG NRPHLRLTGV  360
DDPESVQRLV GGLQIIGLRL ESLAEALGVP FEFHAVPSKT SLVTPSMLEC RPGEALVVNF  420
AFQLHHMPDE SVSTVNQRDQ LLRMVKSLNP KLVTVVEQDM NTNTSPFFPR FIEAYNYYSV  480
VFESLDATLP RESQDRMNVE RQCLARDIVN IIACEGEERI ERYELAGKWR ARMTMAGFTS  540
CPMSADVTDM IRKLIKQYCD RYKLKEELGL LHFGWEDKSL IVASAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-522195876375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434347.10.0hypothetical protein CICLE_v10000671mg
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A067GV230.0A0A067GV23_CITSI; Uncharacterized protein
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69532744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1